Ajmer's bestseller One Week series books on available online

4.38 Rating by ClearWebStats
harshitpublications.com is 5 years 3 months 3 weeks old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, harshitpublications.com is SAFE to browse.
Get Custom Widget

Traffic Report of Harshitpublications

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
80
Siteadvisor Rating
View harshitpublications.com site advisor rating Not Applicable

Where is harshitpublications.com server located?

Hosted IP Address:

162.241.148.33 View other site hosted with harshitpublications.com

Hosted Country:

harshitpublications.com hosted country US harshitpublications.com hosted country

Location Latitude:

40.2342

Location Longitude:

-111.6442

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View harshitpublications.com HTML resources

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 11 H2 Headings: 2
H3 Headings: Not Applicable H4 Headings: 17
H5 Headings: Not Applicable H6 Headings: 1
Total IFRAMEs: Not Applicable Total Images: 24
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 162.241.148.33)

Home - Jennifer Chem Sales

harshitpublications.com favicon - jenniferchemsales.com

View harshitpublications.com Pagerank   harshitpublications.com alexa rank Not Applicable   harshitpublications.com website value $ 8.95

Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute

harshitpublications.com favicon - shrivishwakarmasafetytraininginstitute.com

View harshitpublications.com Pagerank   harshitpublications.com alexa rank Not Applicable   harshitpublications.com website value $ 8.95

The Shine English Academy – DREAM | LEARN | SPEAK

harshitpublications.com favicon - theshineenglishacademy.com

View harshitpublications.com Pagerank   harshitpublications.com alexa rank Not Applicable   harshitpublications.com website value $ 8.95

Urvashi International Packers and Movers|Movers and Packers Hyderabad

harshitpublications.com favicon - urvashiinternationalpackers.com

Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers

View harshitpublications.com Pagerank   harshitpublications.com alexa rank Not Applicable   harshitpublications.com website value $ 8.95

247 Best Pill Pharma – Order Prescription Drugs in our Online shop

harshitpublications.com favicon - 247bestpillpharma.com

View harshitpublications.com Pagerank   harshitpublications.com alexa rank Not Applicable   harshitpublications.com website value $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sat, 07 Dec 2019 17:37:57 GMT
Server: Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 Phusion_Passenger/5.3.7
Upgrade: h2,h2c
Connection: Upgrade
Last-Modified: Fri, 15 Mar 2019 10:37:42 GMT
Accept-Ranges: none
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 6629
Content-Type: text/html

Domain Information for harshitpublications.com

Domain Registrar: Dreamscape Networks International Pte Ltd harshitpublications.com registrar info
Registration Date: 2018-12-20 5 years 3 months 3 weeks ago
Last Modified: 2019-03-14 5 years 1 month 5 days ago

Domain Nameserver Information

Host IP Address Country
ns1.bh-ht-17.webhostbox.net harshitpublications.com name server information 162.241.148.33 harshitpublications.com server is located in United States United States
ns2.bh-ht-17.webhostbox.net harshitpublications.com name server information 162.241.148.33 harshitpublications.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
harshitpublications.com A 10799 IP:162.241.148.33
harshitpublications.com NS 86400 Target:ns1.bh-ht-17.webhostbox.net
harshitpublications.com NS 86400 Target:ns2.bh-ht-17.webhostbox.net
harshitpublications.com SOA 10800 MNAME:ns1.bh-ht-17.webhostbox.net
RNAME:cpanel.webhostbox.net
Serial:2019031003
Refresh:86400
Retry:7200
Expire:3600000
harshitpublications.com MX 14400 Target:harshitpublications.com

Similarly Ranked Websites to Harshitpublications

Google

harshitpublications.com favicon - google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

View harshitpublications.com Pagerank   Alexa rank for harshitpublications.com 1   website value of harshitpublications.com $ 8,833,062,960.00

Google Calendar - Sign in to Access & Edit Your Schedule

harshitpublications.com favicon - calendar.google.com

Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).

View harshitpublications.com Pagerank   Alexa rank for harshitpublications.com 1   website value of harshitpublications.com $ 8,833,062,960.00

Gmail

harshitpublications.com favicon - mail.google.com

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

View harshitpublications.com Pagerank   Alexa rank for harshitpublications.com 1   website value of harshitpublications.com $ 8,833,062,960.00

Android Apps on Google Play

harshitpublications.com favicon - play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

View harshitpublications.com Pagerank   Alexa rank for harshitpublications.com 1   website value of harshitpublications.com $ 8,833,062,960.00

Google Chrome - Download the Fast, Secure Browser from Google

harshitpublications.com favicon - chrome.google.com

Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.

View harshitpublications.com Pagerank   Alexa rank for harshitpublications.com 1   website value of harshitpublications.com $ 8,833,062,960.00

Full WHOIS Lookup for harshitpublications.com

Domain Name: HARSHITPUBLICATIONS.COM
Registry Domain ID: 2345024045_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.crazydomains.com
Registrar URL: http://www.crazydomains.com.au
Updated Date: 2019-03-14T06:15:24Z
Creation Date: 2018-12-20T10:35:53Z
Registry Expiry Date: 2019-12-20T10:35:53Z
Registrar: Dreamscape Networks International Pte Ltd
Registrar IANA ID: 1291
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +61 894 220 890
Domain Status: ok https://icann.org/epp#ok
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS2.BH-HT-17.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-12-07T17:37:40Z